×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: dadgeekgamerpartyminecraftkitchen

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details

Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details


Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details

Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details


MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details

Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details


IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details


Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details

Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details


Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details


Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details

Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details


Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details

Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details

Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details


Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details

True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details


Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details

Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details


LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details

Das Boot

Das Boot.

$34.99Details


10 Sky Lanterns - White

Celebrate a special occasion with these amazing sky lanterns.

$28.99Details

Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details


World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details

Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details

Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details


Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details

PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details


The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details


Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details


Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details

Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details


Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details

Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details


Bodum Brazil 8 cup French Press Coffee Maker, 34 oz, Black

Bodum Brazil offers a classic take on modern, functional design that will never go out of style.

$16.99Details


Presto Pro EverSharp Electric Knife Sharpener

Razor sharp knives whenever you want - easy, automatic. Professional two-stage system sharpens in seconds. Blade guides automatically hold knife at ideal sharpening angle.

$27.00Details

AeroGarden 2101-00B Classic Garden 7-Pod With Gourmet Herb Seed Kit - Black

Enjoy the taste and fragrance of fresh herbs, vegetables and salad greens grown right in your kitchen. The AeroGarden grows them all with no dirt, mess or pesticides.

$149.95Details


Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details

Marini's Candies Chocolate Covered Bacon 1/2 lb. Gift Box

Hickory smoked bacon is cooked in the oven until golden & crisp then it's smothered in milk chocolate.

$12.95Details


Fish Eyes Rod and Reel with Underwater Video Camera

Underwater camera lets you watch what's happening on the line.

$59.99Details

Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details

Hand Held Scalp Head Massager - Set of Three ( Colors May Vary )

It relieves tension as it softly massages acupressure points and stimulates sensitive nerves in your scalp.

$19.99Details


Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details

Transformer USB Flash Memory Drive 4GB

This USB drive transforms from Leopard to USB stick in seconds.

$9.80Details


(4gb MicroSD Bundle) US Mint 1/2 Dollar - Micro SD Card Covert Coin - Secret Compartment

Spy coin helps you turn every day objects into a secret compartment.

$34.99Details

TOTO Washlet - Temperature Controlled Toilet Seat

Cold Toilets are so yesterday.

$409.86Details


Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details

Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details


Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details

Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details


Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details

Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details


Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details


Chessex Dice: Pound of Dice (Pound-O-Dice) Approximately 100 Die

For only the most extreme board game player or gambler.

$18.85Details

iRobot 530 Roomba Vacuuming Robot, White

This specific Roomba model systematically cleans up to three* rooms on a single charge and gets into hard-to-reach wall edges and beneath furniture, while avoiding stairs and other drop-offs.

$249.99Details


Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details

Sony ICFS79W AM/FM/Weather Band Digital Tuner Shower Radio (White)

Listen to your favorite shows while you shower.

$52.58Details


Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details

Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details


Extremely Loud and Incredibly Close MTI: A Novel

Nine-year-old Oskar Schell has embarked on an urgent, secret mission that will take him through the five boroughs of New York.

$9.96Details

Altec Lansing inMotion MIX iMT800 Portable Digital Boom Box for iPhone and iPod

Altec Lansing iMT800 "MIX" Get ready to Rock the house! Versatile iPhone/ iPod docking with three separate inputs and FM radio, LCD display

$299.95Details


Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details

Dynaflex Iron Power Force 1 - Silver, Metal Powerball

The Iron Power Force One Gyro creates up to 16,000 rpm and 50 pounds of silky-smooth dynamic resistance in the palm of your hand.

$99.89Details


iRobot Remote Controlled Cordless Electric Gutter Cleaning Robot

Looj blasts through debris, clogs and sludge and brushes your gutters clean. Stop repeated ladder repositioning and over reaching from dangerous heights.

$129.99Details

Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details


Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details

Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details


Bed Fan

The Bed Fan delivers a cool breeze between the sheets--without AC costs, and without disturbing your partner.

$79.95Details

Kikkerland UL01 Electro Man 4-Plug Multi-Outlet

Meet a powerful man who is more than a boring power outlet. Perfect for home, school or office, his legs and arms have three-prong sockets with enough room even for the biggest adapter.

$21.00Details


MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details

Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details


Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details

Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details


MANGROOMER Do-It-Yourself Electric Back Hair Shaver

The Mangroomer Do-It-Yourself Electric Back Shaver is absolutely the best way to get rid of unwanted back hair.

$39.99Details

Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details


Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details

Fred and Friends OCD Cutting Board

Cut everything to perfection.

$25.00Details


Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details

Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details


Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details

Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details


Emile Henry Flame Top Pizza Stone, Black

Create marvelous pizzas at home.

$50.00Details

Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details


Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details

Diablo III

Shut up and take my money Blizzard.

$59.99Details


Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details

Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details


Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details

Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details


Black Light Reactive Neon Makeup with Black Light Pendant (Yellow)

This awesome UV make up kit allows you to add neon flare to your boring every day make up.

$6.99Details

Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details


Iron Man 2 Macbook Decal Mac Apple skin sticker

A wise man once asked, Is it better to be feared or respected? I say, is it too much to ask for both?

$15.99Details

Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details


Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details

Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details


LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details

Fred & Friends Beat It Chopsticks Set

One end of each chopstick is a regualr chopstick shape while the other end of of the chopstick is in the shape of a drumstick.

$14.99Details


Got Wood?

T-Shirt (Also available as Hoodie)

$24.54Details

Gear Wall Art with Clock

Perfect for the mechanically inclined person in your life. Perfectly balanced between art and utility.

$140.00Details


The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details


Creeper Mousepad

You'll receive one cloth topped mousepad that is backed with non-slip, non-marking rubber.

$12.00Details

Pwned Mug

PWNED.

$9.99Details


Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details

Minecraft Diamond Ring

The ring is adjustable, and the figure is made from Polymer clay. It is painted with acrylic paint and finished with Min-Wax polycrylic to seal and protect it.

$10.00Details



Minecraft inspired Grass Cube Tissue Box Cover

Save your desk or nightstand from those ugly cardboard tissue boxes!

$18.00Details


All American 921 21-1/2-Quart Pressure Cooker/Canner

This heavy-duty pressure cooker's large capacity is probably best utilized for canning (though it would also be great for a number of cooking tasks).

$199.99Details

Fred and Friends PIBOSS Pizza Boss Pizza Wheel

Sick of cutting pizza with a knife? Tired of cutting yourself with a pizza cutter?

$15.00Details


Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details

Minecraft Diamond Earrings

Advertise your love for Minecraft with these rare gems! Here is a pair of gorgeous diamond earrings, straight from the depths of my private mine. Diamonds *are* a miner's best friend.

$10.00Details


3D Pig from Minecraft

Oink! Oink!

$20.00Details

Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details


Carhartt Men's Thermal Lined Duck Active Jacket, Brown, Large Regular

Work proven, our duck active jacket is built with 12-ounce, firm-hand, 100% ring-spun cotton duck with a 100% polyester thermal lining for on-the-job warmth.

$69.99Details

Minecraft Diamond Tool/Weapon Magnet Set

Each magnet has at least one strong round magnet or bar magnet so they're not only fun but functional. See my shop for other Minecraft sets, including this one in iron and gold.

$10.00Details


Kymera Magic Wand Remote Control

Imagine walking into the room with your children and their Muggle friends watching TV, whipping out a magic wand from under your jacket and changing the channel in a flash.

$89.99Details


12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details

Minecraft University Hoodie

Ad Gloriam et Porcos (For pigs and glory!)

$59.99Details


Kotobukiya Samurai Sword Chopsticks Set: Date Masamune

The way of the warrior starts at the dinner table! Based off of real samurai warriors! Meals with honor!

$11.99Details


About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details

Minecraft Note Cube

Leaves no cobblestone residue once fully mined

$14.95Details


Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details

Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details


Minecraft Sheet Magnets

80 1" square blocks on each sheet (2 sheets)

$21.53Details

Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details


The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details

Minecraft Drop it Creep Premium Tee S

A Creeper bounces his way up to an unsuspecting clerk, Give me all your money, bookworm, or I blow up your brainssssSSSsss!

$21.99Details


Fogless Shower Mirror with Squeegee by ToiletTree Products. Guaranteed Not to Fog, Designed Not to Fall.

Look your best by taking care of your face in your shower. This patent pending mirror is guaranteed not to fog in the shower.

$34.95Details


Minecraft Foam Pickaxe

The Minecraft Foam Pickaxe is made from sturdy EVA foam, which means that unlike the stone pickaxe in the game, the Minecraft Foam Pickaxe will withstand far more than 132 uses.

$49.99Details

Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details


Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details

Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details


Minecraft Creeper Anatomy T-Shirt

The Creeper (Creepus explodus) is an all-terrain combustible terror of destruction, indigenous to dark caves found deep beneath the earths crust, and luxurious neighborhoods with glass houses and nice fancy everythings.

$19.99Details

Blendtec Total Blender Four Side, Black

It’s an all-in-one appliance that makes smoothies, fresh juice, ice cream, milkshakes, cappuccinos, margaritas, soups, sauces, breads, dressings, salsas, and more.

$399.99Details


Minecraft Confused Shirt

We presume that to a denizen of Minecraft spheres would be sort of like what non-Euclidean geometry is to us.

$19.99Details

Cute Fire Extinguisher Lighter With LED Light

Irony is always in style, right? Light up with this extinguisher.

$9.00Details


All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details

Minecraft Creeper T-Shirt

Embrace your inner Creeper!

$19.99Details


StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details

Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details


Eat Sleep Minecraft T-Shirt

Eat, Sleep Minecraft

$23.52Details

Official Barney Stinson Armani Grey Suitjamas

A salute to the perfect gentlemen. Never not wear a suit again!

$99.99Details


Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details

THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details


Air Swimmer Remote Control Inflatable Flying Shark

Flying Sharks. Who wouldn't want one?

$39.99Details


Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details

Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details


Sir Creeper of Minecraftia

Sir Creeper is a lover of all things expensive, and your newly acquired diamond is looking really good to him right now.

$24.54Details

Portable Amp For Iphone Horn Stand White

Turn up the sound with science (and not your battery)

$24.99Details


Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details

8 Bit Tie

A reminder of better days.

$14.99Details


Don't Fear the Creeper (Sticker)

There's nothing to fear, all he has is an explosive personality!

$2.40Details

Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


Razer StarCraft II Zerg Edition Messenger Bag

The Starcraft II Zerg Edition Messenger Bag is designed for gamers who want to keep their gear protected, stay comfortable, and look good doing it.

$59.77Details

USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details


Skull & Pickaxes (Sticker)

The traditional Skull & Crossbones with an added Minecraft twist!

$2.40Details

Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details


Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details

© Gift Lizard 2011